DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXI1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:369 Identity:114/369 - (30%)
Similarity:152/369 - (41%) Gaps:114/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DYLRTQVSPNPLAPSAVGGAG---------------------MEGLMCGSFSPAFYYQGID---- 66
            ::...|..|:|..||..||..                     :.|.....|.|..|  |:.    
Human    34 NFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAY--GVQRPLL 96

  Fly    67 -SFLALHNNIWG-LPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYR 129
             |...|..:..| |||.......:..:||:||.|||||||..||::|||||.||:::.|.||:|.
Human    97 PSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYN 161

  Fly   130 ENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQ 194
            ::|.||||||||||||||||.|:|||:      |..|||:||.||.:...||:.||:||:|.|: 
Human   162 KSKAGWQNSIRHNLSLNDCFKKVPRDE------DDPGKGNYWTLDPNCEKMFDNGNFRRKRKRK- 219

  Fly   195 RHCGHPNRYERESGKDSNDGNSSAAE-----------IRSP--SEPLSDFDIFCNERPNYSDRIT 246
                             :|.:||.|.           :.||  :||.   ||.....|.      
Human   220 -----------------SDVSSSTASLALEKTESSLPVDSPKTTEPQ---DILDGASPG------ 258

  Fly   247 DLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSA--- 308
                                  |....||.|..|....|...:|  ..|||..:....||::   
Human   259 ----------------------GTTSSPEKRPSPPPSGAPCLNS--FLSSMTAYVSGGSPTSHPL 299

  Fly   309 FTPPLNRRETSSSGAPVLAEAFNGIKDVVDAPGSSPVAS-SNRS 351
            .||.|:...:..:|...|  .||..         ||:.: ||.|
Human   300 VTPGLSPEPSDKTGQNSL--TFNSF---------SPLTNLSNHS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 55/93 (59%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
FH 123..211 CDD:214627 55/93 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 23/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.