DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXD4

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_997188.2 Gene:FOXD4 / 2298 HGNCID:3805 Length:439 Species:Homo sapiens


Alignment Length:119 Identity:68/119 - (57%)
Similarity:83/119 - (69%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCF 149
            ::.:|.|||.||||||.|||..:|::|||||||..||.|:|||||.....|||||||||||||||
Human    98 DARQPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCF 162

  Fly   150 VKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRY 203
            |||||:..      ..|||:||.||.::.|||:.|::.|||.|.|||...|..:
Human   163 VKIPREPG------RPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQPTPGAH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/93 (62%)
FOXD4NP_997188.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..104 1/5 (20%)
Forkhead 104..189 CDD:306709 57/90 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..232 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.