DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FOXJ3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:332 Identity:97/332 - (29%)
Similarity:141/332 - (42%) Gaps:89/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVK 151
            |:..|||:||.:||..||:|:|.:::|||.||::|.|.||||||...||:||||||||||.||:|
Human    82 HKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLK 146

  Fly   152 IPRDKNTIEDNDSAGKGSYWMLDSS-ASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGN 215
            :||.|      |..||||||.:|:: ..|:......:|.|:           .||.|...|.|.:
Human   147 VPRSK------DDPGKGSYWAIDTNPKEDVLPTRPKKRARS-----------VERASTPYSIDSD 194

  Fly   216 SSAAE--IRSPSEPLSDFDIFCNERPNY-SDRI-TDLHRQYLSVSLGFNSLFN---NEARGLRPL 273
            |...|  |...:.|....:...|:...| :|:. :|..|..|:.||...||.:   |....:...
Human   195 SLGMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSY 259

  Fly   274 PEIRECPDDVDAS----------------------------SSSSKAM----------------- 293
            ..:...|:.|..|                            |:|.:::                 
Human   260 TPVTSHPESVSQSLTPQQQPQYNLPERDKQLLFSEYNFEDLSASFRSLYKSVFEQSLSQQGLMNI 324

  Fly   294 --QSSMELHEEL---HSPSAFT---PPLNRRETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNR 350
              :||.:.|...   ||||:..   |..|:...|:|....|           :..||:.||..:.
Human   325 PSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLSNSHGSGL-----------NTTGSNSVAQVSL 378

  Fly   351 SKTTLFT 357
            |...:.|
Human   379 SHPQMHT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 51/94 (54%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 49/82 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.