DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fkh-4

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_510238.2 Gene:fkh-4 / 181466 WormBaseID:WBGene00001436 Length:421 Species:Caenorhabditis elegans


Alignment Length:342 Identity:69/342 - (20%)
Similarity:112/342 - (32%) Gaps:129/342 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 WGLP----------ISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE 130
            |.||          ||.|      .:||.||:||.|:|..:||:.::|.:|:|.|::..:.|||.
 Worm    99 WRLPSRSVVQPSADISDL------RRPPISYVALCALACRNAPDMKITPAGVYAFVLHHWRYYRY 157

  Fly   131 NKQGWQNSIRHNLSLNDCF--------------------VKIPR--DKNTIEDND---------- 163
            ..:.|:||:||.||..:.|                    ||.|.  .:|.|.|.|          
 Worm   158 ANENWKNSVRHQLSSKEHFDEETFQPDPSNPTVRRKFYIVKNPNMIRQNLISDADFDFFRKDSRG 222

  Fly   164 ---------------------SAGKGSYWMLDSSASDMFEQ--------GNYRRRRTR---RQRH 196
                                 ..|.|..::.....|.||.|        |....|..|   |..|
 Worm   223 IEFYQKMFAGQIGLPRSLFYQIIGNGIPFLAGPENSSMFYQLLGMGKVVGYLETRYFREHYRSEH 287

  Fly   197 CGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNS 261
            .....:||                        .|:..|..:.|:.::.:         :|.|   
 Worm   288 AATEPKYE------------------------EDYANFTEKIPSNAENL---------MSYG--- 316

  Fly   262 LFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSG---- 322
                 |...|...:.....::::....:..:..|..:..:|.:.|:..||.:...||...|    
 Worm   317 -----AATERNFQKFDFTDEEIELFHLNISSYHSVQKTCKECNLPNWCTPSVGDVETYVFGRQVP 376

  Fly   323 ----APVLAEAFNGIKD 335
                .||:.:.|..:.:
 Worm   377 MPVNTPVILQQFETVAE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 38/154 (25%)
fkh-4NP_510238.2 FH 118..206 CDD:214627 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.