DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fkh-3

DIOPT Version :10

Sequence 1:NP_523912.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001294822.1 Gene:fkh-3 / 181465 WormBaseID:WBGene00001435 Length:421 Species:Caenorhabditis elegans


Alignment Length:99 Identity:35/99 - (35%)
Similarity:53/99 - (53%) Gaps:21/99 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 WGLP----------ISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE 130
            |.||          ||.|      .:||.||:||.|:|..:||:.::|.:|:|.||:..:.|||.
 Worm    99 WRLPSRSVVQPSADISDL------RRPPISYVALCALACRNAPDMKITPAGVYAFILHHWRYYRY 157

  Fly   131 NKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDS 164
            ..:.|:||:||.||..:.|     |:.|.:.:.|
 Worm   158 ANENWKNSVRHQLSSKEHF-----DEETFQPDPS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_523912.1 FH_FOX 89..186 CDD:469596 29/76 (38%)
fkh-3NP_001294822.1 FH 118..206 CDD:214627 29/74 (39%)

Return to query results.
Submit another query.