DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fkh-9

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001024760.1 Gene:fkh-9 / 180670 WormBaseID:WBGene00001441 Length:300 Species:Caenorhabditis elegans


Alignment Length:187 Identity:65/187 - (34%)
Similarity:93/187 - (49%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE--NKQGWQNSIRHNLSLNDCFVKI 152
            |:|..||..||..||..:|.:||.|:.||:.|....||||.  ::.||||||||||||:|||||:
 Worm    65 ERPSLSYKDLIIEAIDRSPEKRLKLNEIYQVIRLLHPYYRHRPDQWGWQNSIRHNLSLHDCFVKL 129

  Fly   153 PRDKNTIEDNDSAG-KGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNS 216
            |     ::...::| .|.:|.:....||   :...|||..::.|.....:...|...:|....:.
 Worm   130 P-----LKQTSASGVVGHFWTVVPELSD---KQTLRRRNRQQPRALAKKSDAGRTLSRDDRGSSG 186

  Fly   217 SAAEIRSPSEP-LSDFDIFCNERPNYSDRITDLHRQYLSVSLGFN----SLFNNEAR 268
            |.....|||:| :|.    .||.|..|.:..::    |.:..|.|    :||.|..|
 Worm   187 SGETSPSPSQPSISP----PNENPMPSVQALNV----LELLSGMNDYKGTLFQNNYR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 41/96 (43%)
fkh-9NP_001024760.1 FH 66..153 CDD:214627 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.