DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and pha-4

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001041114.1 Gene:pha-4 / 180357 WormBaseID:WBGene00004013 Length:506 Species:Caenorhabditis elegans


Alignment Length:298 Identity:87/298 - (29%)
Similarity:124/298 - (41%) Gaps:108/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 HNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDC 148
            |.::...|||:|||:||.|||..:.:::||||.||.:|||.||||:.|:|.|||||||:||.|||
 Worm   229 HGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDC 293

  Fly   149 FVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSND 213
            |||:.|..      |..||||:|.|.....:|||.|.|.||:.|.:..       |||..:...:
 Worm   294 FVKVARSP------DKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVK-------EREPSRKKRN 345

  Fly   214 GNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRE 278
            .||.                             .||:|                   :.:|:   
 Worm   346 ANSQ-----------------------------QLHQQ-------------------QHIPK--- 359

  Fly   279 CPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGA----PVLA------EAFNGI 333
                              ||:.||  .|::.|      .|||.||    |.::      |....:
 Worm   360 ------------------MEIKEE--DPTSIT------TTSSLGAYSLIPQISTKKEIKEELKAV 398

  Fly   334 KDVVDA--------PGSSPVASSNRSKTTLFTIDNIIG 363
            :|...|        |..:|.|.::...|::.:....:|
 Worm   399 QDATAAAANLGLIDPSGTPSAVNHSQPTSVISSVGTLG 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 52/93 (56%)
pha-4NP_001041114.1 FH 236..324 CDD:214627 52/93 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.