DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and pes-1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:267 Identity:69/267 - (25%)
Similarity:113/267 - (42%) Gaps:56/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TQVSPNPLAPSAVGGAGMEGL----MC----------GSFSPAFYYQGIDSFLALHNNIWGLPIS 81
            :.:.|.|...::.|.:.|:|.    :|          .|.|||..:......:....:....|:|
 Worm    20 SSLPPTPPKTASPGNSKMKGFNISDLCLDLDSSTSSSCSVSPASSFHTRSESVGQQQSGRNSPVS 84

  Fly    82 FLHNSHRPEK-PPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQ-GWQNSIRHNLS 144
              .::..|.| |.:||.|||||||.|:|.:.|.:|.|||:|...|.||:..|. .||||:|||||
 Worm    85 --SSTESPTKRPKYSYNALIAMAIQSSPFKSLRVSEIYKYISSNFSYYKNQKPLQWQNSVRHNLS 147

  Fly   145 LNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSS-ASDMFEQGNYRRRRTRRQRHCGHPNRYERESG 208
            |:..|.|:    .|::     ||||||.:.:. .:|::...|..:.|.::.:....|...:    
 Worm   148 LHKEFRKV----RTLD-----GKGSYWAMTADLGTDVYISNNCGKLRRQKSKVAKFPPMQQ---- 199

  Fly   209 KDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPL 273
                       ....|..|..:....|.:.|           |.|:..|  .:::....:.|:.:
 Worm   200 -----------HFPIPQLPTQNIHQLCMQNP-----------QILATLL--QNMYLQNMQNLQNI 240

  Fly   274 PEIRECP 280
            |.:...|
 Worm   241 PMVPGFP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 43/96 (45%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 41/83 (49%)
rad23 <203..>240 CDD:273167 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.