DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and fkh-8

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001254107.1 Gene:fkh-8 / 174026 WormBaseID:WBGene00001440 Length:328 Species:Caenorhabditis elegans


Alignment Length:365 Identity:90/365 - (24%)
Similarity:142/365 - (38%) Gaps:82/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VNSMLANPDYLRTQVSPNPLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFL 83
            :|.::|.......|....|..|:.||...:..|:.....||...:               |::..
 Worm    11 LNWLIAKGGLNTVQEIEVPENPNIVGSVNVSPLVLSPTVPAETSK---------------PVAPA 60

  Fly    84 HNSHR------PEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENK-QGWQNSIRH 141
            |...|      .:|||:||..||.:||...|:::.||:.||.||...|.:||||: ..|:|||||
 Worm    61 HEGKRRRIFDGADKPPYSYSQLIRLAIEDTPDKKCTLAEIYSFIAHNFQFYRENRNSSWKNSIRH 125

  Fly   142 NLSLNDCFVKIPRDKNTIEDNDSAGKGSYWM-LDSSASDMFEQGNYRRRRTRRQRHCGHPNR--- 202
            |||||..|.:|.:     .|.|..|   :|: :|..|         ::.|..:    |.|.|   
 Worm   126 NLSLNKQFSRIEK-----TDGDRRG---WWVCVDPPA---------KKPRILK----GSPVRVNP 169

  Fly   203 -YERESGKDSNDGNSSAAEIRSPSEP-LSDFDIFCNERPNYSDRITDLHRQY-LSVSLG--FNSL 262
             ||.......:..|.:.    .|.:| ||:.:...:|...:..|..:|...| |:.|..  :|.:
 Worm   170 IYEHLYHNKQDMPNFTP----PPEDPFLSEINGNVHELTEHEIRDLNLFESYDLNSSFRDVYNQI 230

  Fly   263 FNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLA 327
            |.....     |..::....:|....|.:|  :.::.|:|.......|..|.            .
 Worm   231 FEKSTS-----PNGKKQAAQIDWLKISLEA--AGLDYHDEQELQEVDTDKLK------------D 276

  Fly   328 EAFNGIKDVVDAPGSSPVASSNRSKT-------TLFTIDN 360
            ..:||.....|:..|:|...|.|..:       ||..::|
 Worm   277 YVYNGFPAECDSDVSTPRTDSGRHSSSDSVLSATLQPVNN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 40/95 (42%)
fkh-8NP_001254107.1 COG5025 30..>217 CDD:227358 63/226 (28%)
FH 74..156 CDD:214627 40/98 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.