DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and lin-31

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_494704.1 Gene:lin-31 / 173740 WormBaseID:WBGene00003017 Length:237 Species:Caenorhabditis elegans


Alignment Length:285 Identity:96/285 - (33%)
Similarity:134/285 - (47%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCF 149
            :|:..:|||:|||.|..|||..:.::.|.|:.|||:|||:||:||:|.|.||||:|||||.||||
 Worm     7 DSYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCF 71

  Fly   150 VKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDG 214
            :||||..      |..||||||.:..:||.|||.|:..|||          .|:....|:|.:| 
 Worm    72 IKIPRRA------DRPGKGSYWAVHPNASGMFENGSCLRRR----------KRFRARGGQDDDD- 119

  Fly   215 NSSAAEIRSPSEPLSDFDIFCNERPNYSDR---ITDLHRQYLSVSLGFNSLFNNEARGLRP-LPE 275
                             |.|.:..|:...|   :..|....::..| .:|||.|    |.| ||.
 Worm   120 -----------------DDFHHPAPSKISRKNPLPLLPEPPITPPL-LSSLFPN----LPPSLPN 162

  Fly   276 IRECPDDVDASSSSSKAMQSSMELHEELHSPSAF---TPPLNRRETSSSGAPVLAEAFNGIKDVV 337
            ....|..:|.:.|......|.:.:...|.:.|.|   ||.....|.|.||:.             
 Worm   163 FCLFPPGMDPTKSLLLNPLSLLLMPHFLKNSSNFESSTPHSETSEISGSGSS------------- 214

  Fly   338 DAPGSSPVASSNRSKTTLFTIDNII 362
            .:...:|.|..|.|    |:|::|:
 Worm   215 SSKTPTPEAGFNSS----FSIESIL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 53/93 (57%)
lin-31NP_494704.1 FH 13..101 CDD:214627 53/93 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.