DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and let-381

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_491826.1 Gene:let-381 / 172331 WormBaseID:WBGene00002601 Length:362 Species:Caenorhabditis elegans


Alignment Length:168 Identity:65/168 - (38%)
Similarity:92/168 - (54%) Gaps:11/168 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            |.||||||||||||||||..|:::.||:.||.::.:.|.::|....||:||||||||||:||||:
 Worm    69 RKEKPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFRGEYAGWRNSIRHNLSLNECFVKL 133

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRR----RTRRQRHC-GHPNRYERESGKDSN 212
            |:|..   ::....||..|.:..|...|.|:..:|||    :.|::.|. |.....|...|..:.
 Worm   134 PKDTG---ESYRGRKGHKWTISDSCEFMLEENGFRRRPRGYKARKRTHFPGVTASNEMGIGGATF 195

  Fly   213 DGNSSAAEIRSPSEPLSDFD---IFCNERPNYSDRITD 247
            |..||..|:........:.|   |..|...::...|:|
 Worm   196 DYPSSTTELTDSGTSSLNTDVKNILLNGGEDFGPSISD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 46/93 (49%)
let-381NP_491826.1 Forkhead 71..160 CDD:365978 46/91 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.