DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxa2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001277994.1 Gene:Foxa2 / 15376 MGIID:1347476 Length:465 Species:Mus musculus


Alignment Length:314 Identity:101/314 - (32%)
Similarity:142/314 - (45%) Gaps:59/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VSP--NPLAPSAVGGAGMEGLM----CGSFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHRPEK 91
            :||  :||...|.|..|  ||.    ..|.||.:...|:.....        |.:: ..|:...|
Mouse   112 LSPSLSPLGGQAAGAMG--GLAPYANMNSMSPMYGQAGLSRARD--------PKTY-RRSYTHAK 165

  Fly    92 PPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDK 156
            ||:|||:||.|||..:||:.||||.||::|||.||:||:|:|.|||||||:||.||||:|:||..
Mouse   166 PPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSP 230

  Fly   157 NTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAEI 221
                  |..||||:|.|...:.:|||.|.|.||:.|.:  |......:..:|..|:.|..:|...
Mouse   231 ------DKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK--CEKQLALKEAAGAASSGGKKTAPGS 287

  Fly   222 RSPSEPLSDFDIFCN------ERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECP 280
            ::....|.:.....:      |.|:.|......|::.     |.:.|....|..|.| ||     
Mouse   288 QASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRG-----GLSELKGAPASALSP-PE----- 341

  Fly   281 DDVDASSSSSKAMQSSMELHEELHSPS-------------AFTPPLNRRETSSS 321
                .:.|..:..|::..|....|.|.             ||..|.:.....||
Mouse   342 ----PAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 54/93 (58%)
Foxa2NP_001277994.1 Forkhead_N 23..164 CDD:254796 15/62 (24%)
FH 165..253 CDD:214627 54/93 (58%)
DUF4799 <224..319 CDD:292674 27/102 (26%)
HNF_C 381..454 CDD:286443 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.