DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxf1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:308 Identity:92/308 - (29%)
Similarity:134/308 - (43%) Gaps:93/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            ||||||:||||||.|||.|:|::|||||.||:|:..:||::|...|||:||:|||||||:||:|:
Mouse    45 RPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKL 109

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHC---------------GH--- 199
            |:...      ..|||.||.:|.::..|||:|::|||....:|.|               .|   
Mouse   110 PKGLG------RPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPD 168

  Fly   200 -------------PNRYERESG------------------------KDSNDGNS-------SAA- 219
                         ||....|.|                        ..||.|:|       ||| 
Mouse   169 TYGFQGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAG 233

  Fly   220 -----EIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGF----NSLFNNEARGLRPLPE 275
                 :...|:.||         .|..:..:.:.|..|.|.:..:    ::..|:.|..::..| 
Mouse   234 EYPHHDSSVPASPL---------LPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQP- 288

  Fly   276 IRECPDDVDASSSSSKAMQSSME---LHEELHSPSAFTPPLNRRETSS 320
              ..|.:..|:..|......|:|   ||:..|:..|....:.|..:.|
Mouse   289 --LSPCNPAANPLSGSISTHSLEQPYLHQNSHNGPAELQGIPRYHSQS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/93 (54%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 92/308 (30%)
Forkhead 48..133 CDD:306709 48/90 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.