DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxj1

DIOPT Version :10

Sequence 1:NP_523912.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_032266.3 Gene:Foxj1 / 15223 MGIID:1347474 Length:421 Species:Mus musculus


Alignment Length:111 Identity:49/111 - (44%)
Similarity:69/111 - (62%) Gaps:8/111 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLS 144
            :.:..|.|  .|||:||..||.||:.::...::|||.|||:|.|.|.|:|.....||||||||||
Mouse   112 VDYATNPH--VKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLS 174

  Fly   145 LNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRR 190
            ||.||:|:||:|      |..|||.:|.:|...::....|.:::||
Mouse   175 LNKCFIKVPREK------DEPGKGGFWRIDPQYAERLLSGAFKKRR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_523912.1 FH_FOX 89..186 CDD:469596 45/96 (47%)
Foxj1NP_032266.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..110
FH_FOXJ1 121..199 CDD:410797 43/83 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.