DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxd3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_034555.3 Gene:Foxd3 / 15221 MGIID:1347473 Length:469 Species:Mus musculus


Alignment Length:358 Identity:110/358 - (30%)
Similarity:142/358 - (39%) Gaps:108/358 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 APSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHRPE----KPPFSYIAL 99
            ||.|.|..|.|..:.|...|.          |......||      ..::|:    |||:|||||
Mouse    91 APEADGCKGGEDAVTGGGGPG----------AGSGATGGL------TPNKPKNSLVKPPYSYIAL 139

  Fly   100 IAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDS 164
            |.|||..:|.::||||||.:||.::||||||....||||||||||||||||||||:..      :
Mouse   140 ITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPG------N 198

  Fly   165 AGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLS 229
            .|||:||.||..:.|||:.|::.|||.|.:|   |...:.||.                      
Mouse   199 PGKGNYWTLDPQSEDMFDNGSFLRRRKRFKR---HQQEHLREQ---------------------- 238

  Fly   230 DFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQ 294
                            |.|..|    |.|..||  ..|.|..|............|.:.|..|..
Mouse   239 ----------------TALMMQ----SFGAYSL--AAAAGAGPYGRPYGLHPAAAAGAYSHPAAA 281

  Fly   295 SSMELHEELHSPSAFTP-----------------------------PLNRRETSSSGAPVLAEAF 330
            ::......|..|.|..|                             |..:.:.::.||...|...
Mouse   282 AAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPSLQLQLNTLGAAAAAAGT 346

  Fly   331 NGIKDVVDAPGSSPVASSNRSKTTLFTIDNIIG 363
            .|      |.|::.:..|..|....|:|:||||
Mouse   347 AG------AAGTTSLIKSEPSARPSFSIENIIG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
Foxd3NP_034555.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..127 12/51 (24%)
Forkhead 131..217 CDD:278670 57/91 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.