DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxb2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_032049.1 Gene:Foxb2 / 14240 MGIID:1347468 Length:428 Species:Mus musculus


Alignment Length:315 Identity:95/315 - (30%)
Similarity:133/315 - (42%) Gaps:81/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCF 149
            :|:..:|||:|||:|.||||..:..:.|.||.||||||::||||||:.|.||||:|||||.||||
Mouse     7 SSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCF 71

  Fly   150 VKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTR----RQRHC------------- 197
            :||||..      |..||||:|.|.....||||.|::.|||.|    |..|.             
Mouse    72 IKIPRRP------DQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHAHLHSGSSKGAPGT 130

  Fly   198 ---GHPNRYERESGKDSNDGNSSAA---EIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVS 256
               ||.:.:........:..:..||   ....|.:|         ..|.....:...|:|     
Mouse   131 GPGGHLHPHHPHHAHHHHHHHHHAAHHHHHHHPPQP---------PPPPPPHMVPYFHQQ----- 181

  Fly   257 LGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRE---T 318
                         ..|.|:....|        |..|.|...:     ..|...:.|...:|   .
Mouse   182 -------------PAPAPQPPHLP--------SQPAQQPQPQ-----SQPPQTSHPGKMQEAAAV 220

  Fly   319 SSSGAPVLAEAFNGIKDVVDAP----GSSPVASSNRSKTTL-----FTIDNIIGK 364
            :::.|...|.|...:..:...|    ||:..|::..:.:|.     |.|:||||:
Mouse   221 AAAAAAAAAAAVGSVGRLSQFPPYGLGSAAAAAAAAAASTTGFKHPFAIENIIGR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 55/93 (59%)
Foxb2NP_032049.1 FH 13..101 CDD:214627 55/93 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..217 17/138 (12%)
E_Pc_C <342..>406 CDD:284226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.