DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxd4

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:226 Identity:86/226 - (38%)
Similarity:111/226 - (49%) Gaps:58/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VNSMLANPDYLRTQVSPNPLA---------------------------------------PSAVG 44
            :||  |...:||:...|:||:                                       |.|..
Mouse     1 MNS--ARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHKCLERSLQRPGART 63

  Fly    45 GAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPN 109
            .||.....||..|.:..:  :..|.|...     |.:...:..:|.|||:||||||.|||..:|:
Mouse    64 LAGRSAGDCGDLSNSSGF--LRKFRAPRT-----PATTTADGPQPAKPPYSYIALITMAILQSPH 121

  Fly   110 QRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLD 174
            :|||||||..||..:|||||.....||||||||||||||||||||:..      ..|||:||.||
Mouse   122 KRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPG------HPGKGNYWSLD 180

  Fly   175 SSASDMFEQGNYRRRRTRRQRH----CGHPN 201
            .::.|||:.|::.|||.|.:||    .|||:
Mouse   181 PASQDMFDNGSFLRRRKRFKRHHPPSGGHPH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 12/70 (17%)
Forkhead 103..189 CDD:278670 57/91 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.