DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxm1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_032047.4 Gene:Foxm1 / 14235 MGIID:1347487 Length:757 Species:Mus musculus


Alignment Length:264 Identity:73/264 - (27%)
Similarity:112/264 - (42%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE-NKQGWQNSIRHNLSLNDCFVKIP 153
            |:||:||:|:|..||:|...:|:||..||.:|.|.|||::. .|.||:|||||||||:|.||:  
Mouse   233 ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVR-- 295

  Fly   154 RDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSA 218
                   :..:.||.|:|.:..||                       |||            .:.
Mouse   296 -------ETSANGKVSFWTIHPSA-----------------------NRY------------LTL 318

  Fly   219 AEIRSPSEPLS----DFDIFCNERPNYSDRITDLHRQY---LSVSLGFNSLFNNEARGLRP-LPE 275
            .::..|.||.|    :......:|||     .:|||..   ..:.||       ..|.::| ||.
Mouse   319 DQVFKPLEPGSPQSPEHLESQQKRPN-----PELHRNVTIKTEIPLG-------ARRKMKPLLPR 371

  Fly   276 IRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGIKDVVDAP 340
            :......:....:.|..:|.|:::...| :.|..:..|.|.......||.:..:..||..:   |
Mouse   372 VSSYLVPIQFPVNQSLVLQPSVKVPLPL-AASLMSSELARHSKRVRIAPKVLLSSEGIAPL---P 432

  Fly   341 GSSP 344
            .:.|
Mouse   433 ATEP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 40/94 (43%)
Foxm1NP_032047.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..167
FH 234..309 CDD:238016 38/83 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..348 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..560
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..635
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.