DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and Foxe1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_899121.1 Gene:Foxe1 / 110805 MGIID:1353500 Length:371 Species:Mus musculus


Alignment Length:105 Identity:66/105 - (62%)
Similarity:82/105 - (78%) Gaps:6/105 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||||||:.||.:||||.||||||.::||:||:|.:.|||||||||:|||||:||||:
Mouse    55 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPRE 119

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQR 195
            ..      ..|||:||.||.:|.||||.|::.|||.|.:|
Mouse   120 AG------RPGKGNYWALDPNAEDMFESGSFLRRRKRFKR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 60/93 (65%)
Foxe1NP_899121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..53
FH 55..143 CDD:214627 60/93 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.