DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxd2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:275 Identity:93/275 - (33%)
Similarity:132/275 - (48%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||.|||..:|.:|||||.|.:||.::||||||....||||||||||||||||||||:
 Frog    78 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 142

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAE 220
            ..      :.|||:||.||..::|||:.|::.|||.|.:|             :.||:      .
 Frog   143 PG------NPGKGNYWTLDPESADMFDNGSFLRRRKRFKR-------------QQSNE------I 182

  Fly   221 IRSPSEPLSDFDIFCNERPNYSDRITDLHR-QYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVD 284
            :|.||..:.....:.....||..::.:.|: .:...:..|               :...||....
 Frog   183 LRDPSSFMPAAFGYGPYGYNYGLQLQNYHQHHHTGATFSF---------------QPTHCPLPPP 232

  Fly   285 ASSSSSKAMQSSMELHEELHSPSAFT------PPLNRRETSSSGAPVLAEAFNGIKDVVDAPGSS 343
            ||..||..:  |..|..||...|.::      |.|...:......|..:     |.:::...||:
 Frog   233 ASVFSSPTL--SPFLGNELTRKSFYSQLSPTLPILQTLKPDGQSRPSFS-----IDNIIGGSGST 290

  Fly   344 PVASSNRSKTTLFTI 358
            |      |.|:.:|:
 Frog   291 P------SPTSPYTV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 56/90 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.