DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:304 Identity:98/304 - (32%)
Similarity:130/304 - (42%) Gaps:89/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FYYQGIDSFLALHNNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDK 124
            |.|.|.|           .|........:..:|.:||||||||||..:|:.::||||||.|||.|
 Frog    12 FNYDGDD-----------YPACSSDEEKKFNRPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKK 65

  Fly   125 FPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDS---SASDMFEQGNY 186
            |||||.|::.||||||||||||.||||:||    .|.|:. |||:||...|   |..|:||.|||
 Frog    66 FPYYRSNQRAWQNSIRHNLSLNSCFVKVPR----TEGNEK-GKGNYWSFASGCESMLDLFENGNY 125

  Fly   187 RRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQ 251
            :|||.||...            |...|...:.|:...|.|              :|...:..|  
 Frog   126 KRRRRRRNMK------------KCQKDRKQNQAQALHPGE--------------FSTSSSTAH-- 162

  Fly   252 YLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRR 316
                     .::.||.|                 :.|:|:.|::           .:..|..||:
 Frog   163 ---------VIYGNEKR-----------------TESTSRQMET-----------DSLYPISNRQ 190

  Fly   317 ETSSSGAPVLAEAFNGIKDVVDAPGSSPVASSNRSKTTLFTIDN 360
            ..:||......|....|..::.||...||..|..:     .:||
 Frog   191 SQTSSSLGKSDEIKFSIDYILSAPDPLPVLRSQHN-----VLDN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/96 (60%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 55/90 (61%)
COG5025 33..>224 CDD:227358 91/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.