DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxl2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_004917868.1 Gene:foxl2 / 100486124 XenbaseID:XB-GENE-486612 Length:326 Species:Xenopus tropicalis


Alignment Length:312 Identity:98/312 - (31%)
Similarity:137/312 - (43%) Gaps:96/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SPAFY--YQGIDSFLALHNNIWGLPISFLHNSH-------------------RP---EKPPFSYI 97
            ||..|  .||.|...:..:...|......|||:                   :|   :|||:||:
 Frog    12 SPGCYCLNQGSDRMASFQSPEQGTVALMTHNSNGNKEAERSKEDLLPEKGQEKPDPSQKPPYSYV 76

  Fly    98 ALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDN 162
            |||||||..:..:|||||.||::|:.|||:|.:||:|||||||||||||:||:|:||      :.
 Frog    77 ALIAMAIRESAEKRLTLSAIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPR------EG 135

  Fly   163 DSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEP 227
            ....||:||.||.:..||||:|||||||..::.....|..:  ::||                  
 Frog   136 GGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPTHF--QAGK------------------ 180

  Fly   228 LSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLR--PLP-EIREC--------PD 281
                .:|.::  .|.         |||......|.|.|.:..|.  |.| ....|        |.
 Frog   181 ----SLFSSD--TYG---------YLSPPKYLQSTFMNNSWPLAQPPAPMSYTSCQMAGGNVSPV 230

  Fly   282 DVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGI 333
            :|...|:||.            :||.:        ...|...|.:..::||:
 Frog   231 NVKGLSASSS------------YSPYS--------RVQSMSLPSMVNSYNGM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 54/93 (58%)
foxl2XP_004917868.1 Forkhead 69..155 CDD:365978 52/91 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.