DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxk2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001135634.1 Gene:foxk2 / 100216193 XenbaseID:XB-GENE-483520 Length:645 Species:Xenopus tropicalis


Alignment Length:358 Identity:98/358 - (27%)
Similarity:134/358 - (37%) Gaps:135/358 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPDNEELVNSMLANPDYLRTQVSPNPLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIW 76
            :|||...:.|.|.:|   ...:|.....||:..|||..|...|..                    
 Frog   149 IPDNMAHLISPLPSP---TGTISAANSCPSSPRGAGSSGFKLGRV-------------------- 190

  Fly    77 GLPISFLHNSHRPE---------------KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFP 126
             :|...:..:.:.|               |||:||..||..||:.||:::|||:|||..|...:|
 Frog   191 -IPPDLIAEAAQSENDKDASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYP 254

  Fly   127 YYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLD-SSASDMFEQGNYRRRR 190
            |||...:|||||||||||||..|:|:||.:      :..||||:|.:| :|.|.:.||. :|:||
 Frog   255 YYRTADKGWQNSIRHNLSLNRYFIKVPRSQ------EEPGKGSFWRIDPASESKLVEQA-FRKRR 312

  Fly   191 TRRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSV 255
            .|     |.|.                   .|:|..|||.                         
 Frog   313 PR-----GVPC-------------------FRTPLGPLSS------------------------- 328

  Fly   256 SLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEE------LHSPSAFTPPLN 314
                           |..|   ..|:.....|:.|..:|:...|..|      ...|||..|.| 
 Frog   329 ---------------RSAP---ASPNHAGVLSAHSSGLQTPESLSREGSPIPMEPEPSAIQPKL- 374

  Fly   315 RRETSSSGAPVLAEAFNGIKDVVDAPGSSPVAS 347
                     .|:.||    :....||| ||::|
 Frog   375 ---------AVIQEA----RFAQSAPG-SPLSS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 49/94 (52%)
foxk2NP_001135634.1 FHA 10..117 CDD:238017
Forkhead 218..304 CDD:365978 47/91 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.