DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxl2b

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:279 Identity:93/279 - (33%)
Similarity:138/279 - (49%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            :|||:||:|||||||..:..:||||||||::|:.|||:|.:||:|||||||||||||:||:|:||
Zfish    41 QKPPYSYVALIAMAIRESTEKRLTLSGIYQYIITKFPFYEKNKKGWQNSIRHNLSLNECFIKVPR 105

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAA 219
                  :.....||:||.||.:..||||:||||||  ||.:....|.....::||....|::...
Zfish   106 ------EGGGERKGNYWTLDPACEDMFEKGNYRRR--RRMKRPFRPPAAHFQAGKSLFGGDAYTG 162

  Fly   220 EIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVD 284
            .:.:|....|.|                           .||.:        |||:    |....
Zfish   163 YLPAPKYLQSGF---------------------------MNSSW--------PLPQ----PPPPA 188

  Fly   285 ASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGI--------KDVVDAPG 341
            .|.:|.:....:|...:.|.:||  ..|.:|.:  :.|.|.:..::.|:        :....||.
Zfish   189 MSYASCQMPNGNMGAMKALSTPS--YNPYSRMQ--AMGLPNMMNSYGGMGHHQQPQHQQQSAAPS 249

  Fly   342 SSPVA---SSNRSKTTLFT 357
            :|..|   :.:|....|::
Zfish   250 NSAAALQFTCSRQPAELYS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 55/93 (59%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 55/93 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2284
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.