DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxg1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:216 Identity:90/216 - (41%)
Similarity:105/216 - (48%) Gaps:68/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            |||||||.|||.|||..:|.:||||:|||:|||..||||||||||||||||||||||.||||:||
 Frog   123 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 187

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMF---EQGNYRRRRTRRQRHCG------------------ 198
                  ..|..|||:|||||.|:.|:|   ..|..|||.|..:....                  
 Frog   188 ------HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRA 246

  Fly   199 --------------HPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLH 249
                          ||    |.|...|.:|.:||    .||.|:.           ||..:|   
 Frog   247 GSLYWPMSPFLSLHHP----RASSALSYNGTTSA----YPSHPMP-----------YSSVLT--- 289

  Fly   250 RQYLSVSLGFNSLFNNEARGL 270
                ..|||.|..|:. :.||
 Frog   290 ----QNSLGSNHSFST-SNGL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 63/96 (66%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 63/93 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.