DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxf2

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:290 Identity:99/290 - (34%)
Similarity:147/290 - (50%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            ||||||:||||||.|||.|:|.:|||||.||:|:..:||::|.:.|||:||:|||||||:||:|:
 Frog    59 RPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKL 123

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHC-GHPNRYERESGKDSNDGNS 216
            |:...      ..|||.||.:|.::..|||:|::|||....:|.| .....|...:|    .|.|
 Frog   124 PKGLG------RPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYRMMNG----IGFS 178

  Fly   217 SAA-----EIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLF-NNEARGLRPLP- 274
            ::.     :.::|...|:     |:......|.:::      |::.|::.|. .:....:.|.| 
 Frog   179 TSILPQGFDFQAPPASLT-----CHSNGYNLDMMSN------SMAGGYDGLAGGHHVPHMSPNPG 232

  Fly   275 --EIRECPDD------VDASSS---SSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGA-PVLA 327
              .:..||..      .|:|||   ||.||.|:||.|....||:|        ..:|||| |.|.
 Frog   233 STYMASCPVSSSGDYGPDSSSSPVPSSPAMASAMECHSPYTSPTA--------HWASSGASPYLK 289

  Fly   328 EAFNGIKDVVDAPGSSPVASSNRSKTTLFT 357
            :              .|:..||.:...:.|
 Frog   290 Q--------------QPMPPSNGASAGIHT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/93 (54%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 49/91 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.