DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxe1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:286 Identity:94/286 - (32%)
Similarity:137/286 - (47%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPRD 155
            |||:||||||||||:::.:::|||.||||||.::||:||:|.:.|||||||||:|||||:||||:
 Frog    66 KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPRE 130

  Fly   156 KNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSAAE 220
            ..      ..|||:||.||.:|.|||:.|::.|||.|.:|                .|..:..|.
 Frog   131 PG------RPGKGNYWALDPNAEDMFDSGSFLRRRKRFKR----------------TDLTTYPAY 173

  Fly   221 IRSPS--EPLS------DFDIFCN--ERPNYSDRITDLHRQYLSVS-----------LGFNSLFN 264
            |...|  .||.      ...::.|  ..|:||.:|......|...|           ...|:|..
 Frog   174 IHDTSMFSPLQVARATYPNTVYPNMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVFSINTLIG 238

  Fly   265 NEARGLRPLPEIRECPDDVDASSSSS--------KAMQSSMELHEELHSPSAFTPPLNRRETSSS 321
            :........|. |....:|:::||||        .:...|..:.....:|.:::.|.:..:.:.|
 Frog   239 HSGSEHAQQPN-RSISPEVNSTSSSSCNYGGSTYSSQAGSGTMLPRSTNPYSYSVPNSHLQMNQS 302

  Fly   322 GAPVLAEAFNGIKDVVDAPGSSPVAS 347
            ..|.......|....:..|.|.|:.|
 Frog   303 SYPHSNAQLFGSASRLPMPTSPPMNS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.