DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and MET32

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_010539.1 Gene:MET32 / 851840 SGDID:S000002661 Length:191 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:30/100 - (30%)
Similarity:48/100 - (48%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 RSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLES-ACLKDE 607
            |:.||||.:.||.|...|:..|:||.|.:||.......|.:|.|.||.|..|.:|.:: .|.::.
Yeast    90 RNSTGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDTLTCRRNR 154

  Fly   608 EELM-------------MSMSLSMH-DSNSESGAS 628
            .:|:             :..|..:| ..|:.:|:|
Yeast   155 TKLLTAGGEGINELLKKVKQSNIVHRQDNNHNGSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523
C2H2 Zn finger 469..489 CDD:275370
C2H2 Zn finger 500..520 CDD:275368
COG5048 520..>617 CDD:227381 26/86 (30%)
C2H2 Zn finger 526..546 CDD:275368 1/1 (100%)
zf-H2C2_2 539..562 CDD:290200 8/17 (47%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
zf-C2H2 554..574 CDD:278523 8/19 (42%)
zf-H2C2_2 566..590 CDD:290200 8/23 (35%)
C2H2 Zn finger 582..599 CDD:275368 7/16 (44%)
MET32NP_010539.1 COG5048 <41..191 CDD:227381 29/99 (29%)
C2H2 Zn finger 100..120 CDD:275368 8/19 (42%)
C2H2 Zn finger 128..144 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1379
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.