| Sequence 1: | NP_001261390.1 | Gene: | scrt / 38469 | FlyBaseID: | FBgn0004880 | Length: | 653 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571064.2 | Gene: | snai1b / 792194 | ZFINID: | ZDB-GENE-980526-514 | Length: | 256 | Species: | Danio rerio |
| Alignment Length: | 248 | Identity: | 90/248 - (36%) |
|---|---|---|---|
| Similarity: | 119/248 - (47%) | Gaps: | 73/248 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 371 ASSASSNHMP---SSPSSNSSSSSSQVQNENSNTTNTNPDGDGCLQDGEHSGASGASAKTVAYTY 432
Fly 433 EAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHRS------ 491
Fly 492 ------LDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEK 550
Fly 551 PYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLESAC 603 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrt | NP_001261390.1 | zf-C2H2 | 467..489 | CDD:278523 | 8/21 (38%) |
| C2H2 Zn finger | 469..489 | CDD:275370 | 8/19 (42%) | ||
| C2H2 Zn finger | 500..520 | CDD:275368 | 9/19 (47%) | ||
| COG5048 | 520..>617 | CDD:227381 | 50/84 (60%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 14/19 (74%) | ||
| zf-H2C2_2 | 539..562 | CDD:290200 | 13/22 (59%) | ||
| C2H2 Zn finger | 554..574 | CDD:275368 | 15/19 (79%) | ||
| zf-C2H2 | 554..574 | CDD:278523 | 15/19 (79%) | ||
| zf-H2C2_2 | 566..590 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 582..599 | CDD:275368 | 7/16 (44%) | ||
| snai1b | NP_571064.2 | C2H2 Zn finger | 149..169 | CDD:275368 | 9/19 (47%) |
| C2H2 Zn finger | 175..195 | CDD:275368 | 14/19 (74%) | ||
| zf-H2C2_2 | 188..211 | CDD:316026 | 13/22 (59%) | ||
| zf-C2H2 | 201..223 | CDD:306579 | 15/21 (71%) | ||
| C2H2 Zn finger | 203..223 | CDD:275368 | 15/19 (79%) | ||
| C2H2 Zn finger | 231..247 | CDD:275368 | 6/15 (40%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||