DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and snai2

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001008581.1 Gene:snai2 / 494038 ZFINID:ZDB-GENE-030326-6 Length:257 Species:Danio rerio


Alignment Length:229 Identity:92/229 - (40%)
Similarity:125/229 - (54%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 SSNHMPSSPSSNSSSSSSQVQNENSNTTNTNPDGDGCLQDGEHSGASGASAKTVAYTYEAFFVSD 439
            :::::|.||..:..|..|...:..|:|::..          :|||:....:.           .|
Zfish    60 TTSNLPLSPLPHDLSPISGYPSSLSDTSSNK----------DHSGSESPRSD-----------ED 103

  Fly   440 GRSKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCG 504
            .|.:...::|              ..|:.|..|.|.|:|.|.|.:|||.|....|:.:..|..|.
Zfish   104 ERIQSTKLSD--------------AEKFQCGLCNKSYSTYSGLMKHKQLHCDAQSRKSFSCKYCE 154

  Fly   505 KAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRA 569
            |.|||:.||.||:.||.|...|.:|||.||||||||||:|:||||||:.|.||.:||||||||||
Zfish   155 KEYVSLGALKMHIRTHTLPCVCKMCGKAFSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRA 219

  Fly   570 HMQTHSVDKNFECKRCHKTFALKSYLNKHLESAC 603
            |:||||..|.::||.|.|||:..|.|:||.||.|
Zfish   220 HLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 10/21 (48%)
C2H2 Zn finger 469..489 CDD:275370 10/19 (53%)
C2H2 Zn finger 500..520 CDD:275368 10/19 (53%)
COG5048 520..>617 CDD:227381 55/84 (65%)
C2H2 Zn finger 526..546 CDD:275368 15/19 (79%)
zf-H2C2_2 539..562 CDD:290200 15/22 (68%)
C2H2 Zn finger 554..574 CDD:275368 15/19 (79%)
zf-C2H2 554..574 CDD:278523 15/19 (79%)
zf-H2C2_2 566..590 CDD:290200 15/23 (65%)
C2H2 Zn finger 582..599 CDD:275368 9/16 (56%)
snai2NP_001008581.1 C2H2 Zn finger 119..139 CDD:275368 10/19 (53%)
C2H2 Zn finger 150..170 CDD:275368 10/19 (53%)
C2H2 Zn finger 176..196 CDD:275368 15/19 (79%)
zf-H2C2_2 189..212 CDD:290200 15/22 (68%)
C2H2 Zn finger 204..224 CDD:275368 15/19 (79%)
zf-H2C2_2 216..241 CDD:290200 16/24 (67%)
C2H2 Zn finger 232..248 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.