DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and CG4854

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:171 Identity:55/171 - (32%)
Similarity:81/171 - (47%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 DPAAAA------SGVPTP----DQ---QKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKK- 499
            :||.:|      |..|.|    |:   |...:||:.|...|:....|:.|.:.|      |||| 
  Fly   147 EPAISAPEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVH------SAKKP 205

  Fly   500 --CHTCGKAYVSMPALAMHLLTH--KLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKA 560
              |..|.|.:...|.||.|:.||  ...:.|..|...|:.|.....|.|.||.|:||.|..|.::
  Fly   206 HECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRS 270

  Fly   561 FADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLES 601
            |...:.||.|::||:.::.|.|:.|.|:|:...:.|.|.:|
  Fly   271 FGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275370 5/19 (26%)
C2H2 Zn finger 500..520 CDD:275368 7/19 (37%)
COG5048 520..>617 CDD:227381 28/84 (33%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..562 CDD:290200 9/22 (41%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
zf-C2H2 554..574 CDD:278523 6/19 (32%)
zf-H2C2_2 566..590 CDD:290200 9/23 (39%)
C2H2 Zn finger 582..599 CDD:275368 5/16 (31%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 10/29 (34%)
COG5048 201..>258 CDD:227381 20/56 (36%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 7/22 (32%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 251..273 CDD:290200 10/21 (48%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.