DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and sqz

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:418 Identity:102/418 - (24%)
Similarity:145/418 - (34%) Gaps:166/418 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 YRPYSLDDKPAHGYRRRVPAEEDLHAAHAILDLSASTAFHPPTQPHQLQQQ--QQQQQQQHQHHH 308
            |:|:::.:     :|:.| ||.        ||.|.........|...::||  ..||||||.||.
  Fly    39 YKPFNISE-----FRQNV-AER--------LDYSLKNGLVQHQQQMVMEQQPHPDQQQQQHLHHP 89

  Fly   309 SQQQHLAPQQHHYL-----PLQQQQQQQAHHTHLPTLEAHAHLRSTSSIAELAAAASVVNEQRPA 368
            .||||....:..|.     |...:||:|.:..                           |...|.
  Fly    90 QQQQHPPQLKVSYSAPNSPPTPHEQQEQKYDP---------------------------NRSPPR 127

  Fly   369 SNASSASSNHMPSSPSSNSSSSSSQVQNENSNTTNTNPDGDGCLQDGEHSGASGASAKTVAYTYE 433
            ...||||        .|.|:.||.:.::..         |||                       
  Fly   128 QQMSSAS--------GSGSNGSSPEEESRR---------GDG----------------------- 152

  Fly   434 AFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAK 498
                                       ||.| .|.|..|.|.:|.||.||:|.:.|..:      
  Fly   153 ---------------------------DQAK-PYKCGSCSKSFANSSYLSQHTRIHLGI------ 183

  Fly   499 KCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAH--CGKAF 561
                  |.|                 .|.:|.:.|::...||.|:|:|||:|||.|.|  |.|||
  Fly   184 ------KPY-----------------RCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAF 225

  Fly   562 ADRSNLRAHMQTHSVDKNFECKRCHKTFA----LKSYLNKHLESACLKDE----------EELMM 612
            :..|||::|.:.|..||.|:|..|:|.|:    |..::.||.:|..||..          :|..:
  Fly   226 SQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKSYTQETYL 290

  Fly   613 SMSLSMHDSNSES-----GASMASSPPH 635
            ...|..|...:|.     .|.:|:...|
  Fly   291 QKHLQKHAEKAEKQQHRHTAQVAAHQQH 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 10/21 (48%)
C2H2 Zn finger 469..489 CDD:275370 9/19 (47%)
C2H2 Zn finger 500..520 CDD:275368 2/19 (11%)
COG5048 520..>617 CDD:227381 38/112 (34%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..562 CDD:290200 15/24 (63%)
C2H2 Zn finger 554..574 CDD:275368 10/21 (48%)
zf-C2H2 554..574 CDD:278523 10/21 (48%)
zf-H2C2_2 566..590 CDD:290200 10/23 (43%)
C2H2 Zn finger 582..599 CDD:275368 6/20 (30%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 9/19 (47%)
zf-H2C2_2 172..197 CDD:290200 9/53 (17%)
zf-C2H2 186..208 CDD:278523 8/38 (21%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
zf-C2H2_8 191..271 CDD:292531 34/79 (43%)
zf-H2C2_2 200..227 CDD:290200 16/26 (62%)
C2H2 Zn finger 216..238 CDD:275368 10/21 (48%)
C2H2 Zn finger 246..266 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.