DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and CG14710

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:181 Identity:53/181 - (29%)
Similarity:79/181 - (43%) Gaps:8/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 KRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAY 507
            |||   |..|...|.....:::.|:.|..||..:...|..:.|..||   ......:|..|.|::
  Fly   241 KRK---DINAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTH---SEYKPHQCEICNKSF 299

  Fly   508 VSMPALAMHLLTH--KLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAH 570
            ..|..|..|:..|  ...:.|..|.:.|........|.|.||..:||.|..|||.|...:.|:.|
  Fly   300 RQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNH 364

  Fly   571 MQTHSVDKNFECKRCHKTFALKSYLNKHLESACLKDEEELMMSMSLSMHDS 621
            :.:||..||:.|..|.|:|.|...|..||::...:::.|..:..|..|.:|
  Fly   365 ILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNKMEQTIPSSPEMLES 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 5/21 (24%)
C2H2 Zn finger 469..489 CDD:275370 5/19 (26%)
C2H2 Zn finger 500..520 CDD:275368 6/19 (32%)
COG5048 520..>617 CDD:227381 31/98 (32%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..562 CDD:290200 10/22 (45%)
C2H2 Zn finger 554..574 CDD:275368 7/19 (37%)
zf-C2H2 554..574 CDD:278523 7/19 (37%)
zf-H2C2_2 566..590 CDD:290200 9/23 (39%)
C2H2 Zn finger 582..599 CDD:275368 6/16 (38%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 43/136 (32%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 6/21 (29%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..327 CDD:290200 5/22 (23%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:290200 11/21 (52%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
C2H2 Zn finger 376..395 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.