DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and Blimp-1

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:710 Identity:162/710 - (22%)
Similarity:239/710 - (33%) Gaps:210/710 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RSTLDDDEEIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHS---------SNSSNME---- 100
            ||.:...:: |..|.. |..|:.|.|..|.:..:..|.|...|:.         .:||:.|    
  Fly   394 RSPMASSDK-DTAGSP-LSGLDHQMTPQDGSVRSVRSDEGYHSNECHEDGLTPPEDSSDSESEHN 456

  Fly   101 ----------ASATTTTSKCWGPSSP-----TAGTTAPSPPPHSPEAATRVAGNVYNGYT--REL 148
                      |...|..::...|||.     .|.||..|...||...||.:.....|.|.  :..
  Fly   457 YVLDCSKKAIAPKETVIAQAQKPSSSPPAVVMANTTTNSMISHSSPTATPICETDKNEYRKFKVK 521

  Fly   149 SPLHY-------------------TAYLPRMESEITVIRAAATALVAARTSGNGSGDQHL----- 189
            .||.|                   ...||:.|.|..|:.....::..:.|:  ..||:|:     
  Fly   522 MPLKYEFKNKTCVKQEPSLKEVDQEMSLPQEEEEDQVMHPEPDSICPSTTT--HLGDEHMLMMER 584

  Fly   190 -------------AAYQTPPSSTT-----------------SSPSCSPSGAGDRYSPLSSGQTSS 224
                         .:.|.|.|||.                 |.|...|...|:||  :..||.||
  Fly   585 ERERERERIQEREPSNQQPASSTVIVLEHNSGGQARTIVPLSKPYYEPDPPGERY--MRFGQPSS 647

  Fly   225 E-------------------RKCFSSTGATLSLPPKKKDIYRPYSLDDKPAHGYRRRVPAEEDLH 270
            .                   ..|..:..||   ||........||.  |.:..|...|..:...:
  Fly   648 SILETILTSQHRLEAAAAAANACRQANAAT---PPPTSPTEMAYSY--KKSQRYGNAVSPDSSSN 707

  Fly   271 AAHAILDLSASTAF---HPPTQPHQLQQQQQQQQQQHQHHH---SQQQHLAPQQHHYLPLQQQQQ 329
            .......||:|...   ...|:...::.:.......|.||:   |..:|.|     ||    ...
  Fly   708 LGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPPPSHHHHNVIFSPSRHAA-----YL----GAG 763

  Fly   330 QQAHHTHLPTLEAHAHLRSTSSIAELAAAASVVNEQRPASNASSASSNHMPSSPSSNSSSSSSQV 394
            :...|:..|....:.|..        |||.|..:        |...|:|.|....||:||.:...
  Fly   764 EAGGHSPSPGYPGYPHYG--------AAATSTFH--------SPPHSSHSPFDRQSNASSGAGSA 812

  Fly   395 QNENSNTTNT----------------------------NPDGDGCLQDGEHSGASGASAKTVAYT 431
            .|.:...|:|                            :|||:.|.:.|     |..|..::|  
  Fly   813 TNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCPRSG-----SPLSPNSLA-- 870

  Fly   432 YEAFFVSDGRSKRKHVADPAAAASGVPTPDQQ---KTKYTCSECGKQYATSSNLSRHKQTHRSLD 493
                    .|..|           .:|.|.::   |..|.|:.|.|.:...|||..|.:||   .
  Fly   871 --------SRGYR-----------SLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTH---S 913

  Fly   494 SQSAKKCHTCGKAYVSMPALAMHLLTH--KLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAH 556
            .:...||:.|.|::..:..|..|.|.|  :..|.|.:|.|.||....|:.|||.|:|:|||.|..
  Fly   914 GERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL 978

  Fly   557 CGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLESACLKD---EEELMMS 613
            |.:.|....:|:.|.:.|:.|:.:.|:.|.|.:...|.|..|.::...|.   ||||.|:
  Fly   979 CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEELAMA 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275370 7/19 (37%)
C2H2 Zn finger 500..520 CDD:275368 6/19 (32%)
COG5048 520..>617 CDD:227381 35/99 (35%)
C2H2 Zn finger 526..546 CDD:275368 9/19 (47%)
zf-H2C2_2 539..562 CDD:290200 11/22 (50%)
C2H2 Zn finger 554..574 CDD:275368 5/19 (26%)
zf-C2H2 554..574 CDD:278523 5/19 (26%)
zf-H2C2_2 566..590 CDD:290200 7/23 (30%)
C2H2 Zn finger 582..599 CDD:275368 5/16 (31%)
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 7/19 (37%)
zf-H2C2_2 904..929 CDD:290200 9/27 (33%)
C2H2 Zn finger 920..940 CDD:275368 6/19 (32%)
zf-H2C2_2 932..957 CDD:290200 9/24 (38%)
C2H2 Zn finger 948..968 CDD:275368 9/19 (47%)
zf-H2C2_2 960..985 CDD:290200 12/24 (50%)
C2H2 Zn finger 976..996 CDD:275368 5/19 (26%)
C2H2 Zn finger 1004..1023 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.