DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment scrt and CG1603

DIOPT Version :9

Sequence 1:	NP_001261390.1	Gene:	scrt / 38469	FlyBaseID:	FBgn0004880	Length:	653	Species:	Drosophila melanogaster
Sequence 2:	NP_001260778.1	Gene:	CG1603 / 35683	FlyBaseID:	FBgn0033185	Length:	586	Species:	Drosophila melanogaster

Alignment Length:	141	Identity:	45/141 - (31%)
Similarity:	68/141 - (48%)	Gaps:	12/141 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   467 YTCSECGKQYATSSNLSRHK-QTH--RSLDSQSAKKCHTCGKAYVSMPALAMHLLTH--KLSHSC 526
            |.||.|.:::....::.||| ::|  |.|      ||..|.|::.....|.:|.|.|  :..|.|
  Fly   448 YLCSFCPRRFDRHVDMDRHKLRSHFERKL------KCQYCEKSFAVDTDLKVHTLIHTGERPHVC 506

  Fly   527 GVCGKLFSRPWLLQGHLRS-HTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFA 590
            .:|||.|....||..|:.. |...:||.|..|.|.|..:..|..|::.|...::.:|:.|..||.
  Fly   507 DICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFY 571

  Fly   591 LKSYLNKHLES 601
            ..|.|::|..|
  Fly   572 DHSSLSRHRRS 582

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
scrt	NP_001261390.1	zf-C2H2	467..489	CDD:278523	7/22 (32%)
		C2H2 Zn finger	469..489	CDD:275370	6/20 (30%)
		C2H2 Zn finger	500..520	CDD:275368	6/19 (32%)
		COG5048	520..>617	CDD:227381	28/85 (33%)
		C2H2 Zn finger	526..546	CDD:275368	8/20 (40%)
		zf-H2C2_2	539..562	CDD:290200	8/23 (35%)
		C2H2 Zn finger	554..574	CDD:275368	6/19 (32%)
		zf-C2H2	554..574	CDD:278523	6/19 (32%)
		zf-H2C2_2	566..590	CDD:290200	6/23 (26%)
		C2H2 Zn finger	582..599	CDD:275368	6/16 (38%)
CG1603	NP_001260778.1	MADF_DNA_bdg	202..287	CDD:287510
		GT1	321..408	CDD:304916
		C2H2 Zn finger	420..441	CDD:275368
		COG5048	<424..583	CDD:227381	45/141 (32%)
		C2H2 Zn finger	450..471	CDD:275368	6/20 (30%)
		C2H2 Zn finger	478..498	CDD:275368	6/19 (32%)
		zf-H2C2_2	490..513	CDD:290200	9/22 (41%)
		C2H2 Zn finger	506..527	CDD:275368	8/20 (40%)
		C2H2 Zn finger	535..555	CDD:275368	6/19 (32%)
		C2H2 Zn finger	563..583	CDD:275368	8/20 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45457076
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930