DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and crol

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:695 Identity:142/695 - (20%)
Similarity:247/695 - (35%) Gaps:171/695 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSPTAGTTAPSPPPHSPEAATRVAGN 139
            :|.||||||:::.||.:....|:|..|:|....|...|....|:|.........:..::|...|:
  Fly   104 SAAAAAAAASTNNAAVAAVMASANAAAAAAAAASAGGGLPPATSGNGGQQVTVTTTSSSTSSGGS 168

  Fly   140 VYNGYTRELSPLHYTA---YLPRMESEITVIRAAATALVAARTSGNG--SGDQHLAAYQTPPSST 199
            ..:|.|..      ||   .:|:||..|..:..          ||||  .|.|::|.........
  Fly   169 TTSGGTTT------TAGELLMPKMEGGIHGVDG----------SGNGGNGGGQNVALAPDGTPIA 217

  Fly   200 TSSPSCSPSGA--GDRYSPLSSGQTSSERK----------------------------------C 228
            |.:..|...|.  ..||..:...:..||||                                  |
  Fly   218 TGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC 282

  Fly   229 FS--STGATLSLPPKKKDIYRPYS-------------LDDK-PAH----GYRRRVPAEEDLHAAH 273
            |:  :...:|....|:....:|::             ||:. .:|    .:|.:..|:......|
  Fly   283 FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEH 347

  Fly   274 AILDLSASTAFHPPTQPHQ--LQQQQQQQQQQHQHHHSQQQHLAPQQHHYLPLQQQQQQQ-AHHT 335
            .:..:..    |....||:  :.::...:::.:.:|:.......|.|......:..:::. |:| 
  Fly   348 MVNHVRK----HTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANH- 407

  Fly   336 HLPTLEAHAHLRSTSSIAELAAAASVVNEQRPASNASSASSNHM----PSSP-----SSNSSSSS 391
                  ..:|...|....|:...:....|.         .:||:    ..:|     .|.:.:..
  Fly   408 ------MRSHTNETPFRCEICGKSFSRKEH---------FTNHILWHTGETPHRCDFCSKTFTRK 457

  Fly   392 SQVQNENSNTTNTNPDG-DGCLQD-----------GEHSGASGASAK--TVAYTYEAFFVSDGR- 441
            ..:.|.....|..:|.. ..|::.           .:|:|.:.....  |.|:|.:...|:..| 
  Fly   458 EHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ 522

  Fly   442 ----------------SKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHR 490
                            ::::|:.:.....:|       .:.:.||.|.|.:....:|:.|.:.| 
  Fly   523 HTGESPHKCTYCTKTFTRKEHLTNHVRQHTG-------DSPHRCSYCKKTFTRKEHLTNHVRLH- 579

  Fly   491 SLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLS--HSCGVCGKLFSRPWLLQGHL-RSHTGEKPY 552
              ...|..||..|.|.:.....|..|:..|...  |.|.||.|.|:|...|..|: |.|||::|:
  Fly   580 --TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF 642

  Fly   553 GCAHCGKAFADRSNLRAHMQTHS----VDKNFECKRCHKTFALKSYLNKHLES-------ACLKD 606
            .|..|||:|..:.||..|.::|:    :::.|.|::|.|.|..|.:|..|:.|       ||...
  Fly   643 TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLC 707

  Fly   607 EEELMMSMSLSMHDSNSESGASMASSPPHE-------FLERVKLE 644
            .:..:...:|..|...:...|.|...|.|.       .|.:||.|
  Fly   708 SKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQE 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275370 6/19 (32%)
C2H2 Zn finger 500..520 CDD:275368 5/19 (26%)
COG5048 520..>617 CDD:227381 35/110 (32%)
C2H2 Zn finger 526..546 CDD:275368 9/20 (45%)
zf-H2C2_2 539..562 CDD:290200 11/23 (48%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
zf-C2H2 554..574 CDD:278523 8/19 (42%)
zf-H2C2_2 566..590 CDD:290200 8/27 (30%)
C2H2 Zn finger 582..599 CDD:275368 6/16 (38%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 4/19 (21%)
C2H2 Zn finger 251..271 CDD:275368 0/19 (0%)
C2H2 Zn finger 279..299 CDD:275368 4/19 (21%)
COG5048 300..723 CDD:227381 87/452 (19%)
C2H2 Zn finger 307..327 CDD:275368 2/19 (11%)
C2H2 Zn finger 335..355 CDD:275368 2/23 (9%)
C2H2 Zn finger 363..383 CDD:275368 1/19 (5%)
C2H2 Zn finger 391..411 CDD:275368 2/26 (8%)
C2H2 Zn finger 419..439 CDD:275368 4/28 (14%)
C2H2 Zn finger 447..467 CDD:275368 2/19 (11%)
C2H2 Zn finger 475..495 CDD:275368 1/19 (5%)
C2H2 Zn finger 503..523 CDD:275368 5/19 (26%)
C2H2 Zn finger 531..551 CDD:275368 1/19 (5%)
C2H2 Zn finger 559..579 CDD:275368 6/19 (32%)
C2H2 Zn finger 587..607 CDD:275368 5/19 (26%)
C2H2 Zn finger 615..636 CDD:275368 9/20 (45%)
C2H2 Zn finger 644..664 CDD:275368 8/19 (42%)
C2H2 Zn finger 676..696 CDD:275368 7/19 (37%)
C2H2 Zn finger 704..722 CDD:275368 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.