| Sequence 1: | NP_001261390.1 | Gene: | scrt / 38469 | FlyBaseID: | FBgn0004880 | Length: | 653 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_840101.1 | Gene: | SNAI3 / 333929 | HGNCID: | 18411 | Length: | 292 | Species: | Homo sapiens |
| Alignment Length: | 220 | Identity: | 92/220 - (41%) |
|---|---|---|---|
| Similarity: | 114/220 - (51%) | Gaps: | 41/220 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 416 EHSGASGASAKTVAYTYEAFFVSDGRSKR----------KHVADPAAAASGVPT-------PDQQ 463
Fly 464 KTK---------------YTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPAL 513
Fly 514 AMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDK 578
Fly 579 NFECKRCHKTFALKSYLNKHLESAC 603 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrt | NP_001261390.1 | zf-C2H2 | 467..489 | CDD:278523 | 9/21 (43%) |
| C2H2 Zn finger | 469..489 | CDD:275370 | 9/19 (47%) | ||
| C2H2 Zn finger | 500..520 | CDD:275368 | 9/19 (47%) | ||
| COG5048 | 520..>617 | CDD:227381 | 55/84 (65%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 15/19 (79%) | ||
| zf-H2C2_2 | 539..562 | CDD:290200 | 16/22 (73%) | ||
| C2H2 Zn finger | 554..574 | CDD:275368 | 15/19 (79%) | ||
| zf-C2H2 | 554..574 | CDD:278523 | 15/19 (79%) | ||
| zf-H2C2_2 | 566..590 | CDD:290200 | 15/23 (65%) | ||
| C2H2 Zn finger | 582..599 | CDD:275368 | 8/16 (50%) | ||
| SNAI3 | NP_840101.1 | SNAG domain. /evidence=ECO:0000250 | 1..20 | ||
| C2H2 Zn finger | 154..174 | CDD:275370 | 9/19 (47%) | ||
| C2H2 Zn finger | 185..205 | CDD:275368 | 9/19 (47%) | ||
| COG5048 | <206..>278 | CDD:227381 | 48/71 (68%) | ||
| C2H2 Zn finger | 211..231 | CDD:275368 | 15/19 (79%) | ||
| C2H2 Zn finger | 239..259 | CDD:275368 | 15/19 (79%) | ||
| C2H2 Zn finger | 267..283 | CDD:275368 | 8/15 (53%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||