DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and CG42726

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:140 Identity:50/140 - (35%)
Similarity:75/140 - (53%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 KYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTH-KLSHSCGVC 529
            |:.|.|||:::||||:|..|..:|   :.||...|..|.|::.....|..|:||| :..|.|.:|
  Fly   100 KFNCKECGRRFATSSHLKYHLMSH---EKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPIC 161

  Fly   530 GKLFSRPWLLQGHLRSHTG-EKPYGCAHCGKAFADRSNLRAHMQTHSVDKN---FECKRCHKTFA 590
            .|:|.|...|..||..|:. ...:.|..|.|.|.:::||..|::.|  |||   ..||.|.|:|.
  Fly   162 QKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKH--DKNNIRHMCKVCQKSFL 224

  Fly   591 LKSYLNKHLE 600
            .::.|..|::
  Fly   225 RQTTLRLHMK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 10/21 (48%)
C2H2 Zn finger 469..489 CDD:275370 10/19 (53%)
C2H2 Zn finger 500..520 CDD:275368 6/19 (32%)
COG5048 520..>617 CDD:227381 29/86 (34%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 539..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..574 CDD:275368 7/19 (37%)
zf-C2H2 554..574 CDD:278523 7/19 (37%)
zf-H2C2_2 566..590 CDD:290200 11/26 (42%)
C2H2 Zn finger 582..599 CDD:275368 6/16 (38%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 10/19 (53%)
COG5048 <112..288 CDD:227381 44/128 (34%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 29/86 (34%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.