DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and CG32772

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster


Alignment Length:361 Identity:94/361 - (26%)
Similarity:148/361 - (40%) Gaps:82/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 AAHAILDLSASTAFHPPTQPHQLQQQQQQQQQQHQHHHSQQQHLAPQQHHYLPLQQQQQQQAHHT 335
            |:.|....|:|||....:.. ..||||.|..||.||.:||||            ||||||....:
  Fly    58 ASAAAAATSSSTASSSDSDA-IAQQQQHQNPQQQQHQNSQQQ------------QQQQQQMQSSS 109

  Fly   336 HLPTLEAHAHLRSTSSIAELAAAASVVNEQRPASNASSASSNHMPSSPSSNSSSSSSQVQNENSN 400
            ....|::    :..|...:|     :.||:         .|..:.:...|..||..:.::|    
  Fly   110 SSENLQS----QDDSEDVDL-----IFNEE---------GSCPLCNKTFSRKSSLMTHIRN---- 152

  Fly   401 TTNTNPDGDGCLQDGEHSGASGASAKTV-AYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQK 464
                            ||    |..|.| .|.::.|  :...:.|.|        ..:.|.|:  
  Fly   153 ----------------HS----AERKFVCTYCHKGF--TQAANLRNH--------ERIHTNDR-- 185

  Fly   465 TKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCH--TCGKAYVSMPALAMHLLTHK--LSHS 525
             .|.|.:|||.:...:||:.|::.|   ..:....|:  .||:::..:..|..|:.:|.  ..:.
  Fly   186 -PYQCVDCGKTFTQITNLNNHRRLH---TGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYC 246

  Fly   526 CGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHC-GKAFADRSNLRAHMQTHSVDKNFECKRCHKTF 589
            |.||.|.|::...|..||::|.|...|.|..| .|.|..:|.|..||:||.:...:||.:|.:.|
  Fly   247 CNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKF 311

  Fly   590 ALKSYLNKHLESACLKDEEELMMSMSLSMHDSNSES 625
            ..:::|::|     ||..:|......:.....|.||
  Fly   312 LQQAHLDQH-----LKMHDEFKFKCDICPSSFNQES 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275370 7/19 (37%)
C2H2 Zn finger 500..520 CDD:275368 5/21 (24%)
COG5048 520..>617 CDD:227381 31/99 (31%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 539..562 CDD:290200 9/23 (39%)
C2H2 Zn finger 554..574 CDD:275368 8/20 (40%)
zf-C2H2 554..574 CDD:278523 8/20 (40%)
zf-H2C2_2 566..590 CDD:290200 8/23 (35%)
C2H2 Zn finger 582..599 CDD:275368 4/16 (25%)
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 67/278 (24%)
C2H2 Zn finger 133..153 CDD:275368 4/39 (10%)
zf-H2C2_2 145..170 CDD:290200 9/50 (18%)
C2H2 Zn finger 161..181 CDD:275368 4/29 (14%)
zf-H2C2_2 173..198 CDD:290200 9/35 (26%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..239 CDD:275368 5/21 (24%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
C2H2 Zn finger 275..296 CDD:275368 8/20 (40%)
C2H2 Zn finger 304..324 CDD:275368 7/24 (29%)
C2H2 Zn finger 331..351 CDD:275368 3/12 (25%)
C2H2 Zn finger 359..380 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.