DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and Zfp641

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001100262.1 Gene:Zfp641 / 300197 RGDID:1310412 Length:421 Species:Rattus norvegicus


Alignment Length:249 Identity:71/249 - (28%)
Similarity:99/249 - (39%) Gaps:77/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 GDGCLQDGEHSG------------ASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTP 460
            |||    ||..|            .|..|.:||.:.     ...|.|.|   :.|:::...:|.|
  Rat   174 GDG----GEPKGDTPELETEPSRTLSSMSEETVLWN-----PGQGPSWR---SMPSSSTGTLPRP 226

  Fly   461 -----------------DQQKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCH-TCGKAY 507
                             |.....:||.:||||:...|:|:||:|||......|..||. :.|:.:
  Rat   227 RFLQEDSVSHLLRSTDTDSLLKPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRH 291

  Fly   508 VSMPALAMHLLTHKLSH------SCGVCGKLFSRPWLLQGHLRSHT----------GEKP----- 551
                    ||:.|:.:|      .|..|||.|.....|..|.|.|.          ||.|     
  Rat   292 --------HLIRHQKTHLHDKPSRCPECGKTFRCSSHLASHQRVHADSKSCKGQEIGESPGAQCA 348

  Fly   552 ------YGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHL 599
                  :.|..|||:|..|.:|..|..||:.:|.|.|.||.|:|..|.:|::||
  Rat   349 PPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFHCPRCEKSFGRKHHLDRHL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 11/21 (52%)
C2H2 Zn finger 469..489 CDD:275370 10/19 (53%)
C2H2 Zn finger 500..520 CDD:275368 4/20 (20%)
COG5048 520..>617 CDD:227381 35/107 (33%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 539..562 CDD:290200 11/43 (26%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
zf-C2H2 554..574 CDD:278523 8/19 (42%)
zf-H2C2_2 566..590 CDD:290200 10/23 (43%)
C2H2 Zn finger 582..599 CDD:275368 7/16 (44%)
Zfp641NP_001100262.1 PLN03206 <13..90 CDD:178745
KRAB 95..156 CDD:214630
COG5048 <208..402 CDD:227381 59/204 (29%)
C2H2 Zn finger 252..272 CDD:275368 10/19 (53%)
C2H2 Zn finger 280..300 CDD:275368 6/27 (22%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..405 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4772
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.