Sequence 1: | NP_001261390.1 | Gene: | scrt / 38469 | FlyBaseID: | FBgn0004880 | Length: | 653 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006236507.1 | Gene: | Zfp212 / 297066 | RGDID: | 1307836 | Length: | 492 | Species: | Rattus norvegicus |
Alignment Length: | 276 | Identity: | 67/276 - (24%) |
---|---|---|---|
Similarity: | 95/276 - (34%) | Gaps: | 98/276 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 380 PSS-PSSNSSSSSSQVQNENSNTTNTNPDGDGCLQDGEHSGASGASAKTVAYTYEAFFVSDGRSK 443
Fly 444 RKHVADPAAAASGVPTPDQQK---------------------TKYTCSECGKQYATSSNLSRHKQ 487
Fly 488 THRSLDSQSA-------------------KKCHTCGKAYVSMPALAMHLLTHKLSHS-------- 525
Fly 526 ----------------------------CGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFA 562
Fly 563 DRSNLRAHMQTHSVDK 578 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scrt | NP_001261390.1 | zf-C2H2 | 467..489 | CDD:278523 | 8/21 (38%) |
C2H2 Zn finger | 469..489 | CDD:275370 | 7/19 (37%) | ||
C2H2 Zn finger | 500..520 | CDD:275368 | 4/19 (21%) | ||
COG5048 | 520..>617 | CDD:227381 | 26/95 (27%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 539..562 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 554..574 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 554..574 | CDD:278523 | 6/19 (32%) | ||
zf-H2C2_2 | 566..590 | CDD:290200 | 3/13 (23%) | ||
C2H2 Zn finger | 582..599 | CDD:275368 | |||
Zfp212 | XP_006236507.1 | KRAB_A-box | 142..180 | CDD:143639 | |
zf-C2H2 | 313..335 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <329..>474 | CDD:227381 | 38/145 (26%) | ||
C2H2 Zn finger | 368..388 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 11/19 (58%) | ||
zf-C2H2 | 426..446 | CDD:278523 | 11/19 (58%) | ||
zf-H2C2_2 | 438..463 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 111 | 1.000 | Inparanoid score | I4772 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |