DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrt and snai-1

DIOPT Version :9

Sequence 1:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_499902.2 Gene:snai-1 / 186874 WormBaseID:WBGene00019299 Length:193 Species:Caenorhabditis elegans


Alignment Length:173 Identity:77/173 - (44%)
Similarity:97/173 - (56%) Gaps:14/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 SKRKHVAD-----------PAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQ 495
            :|||.:.:           |::::|..........|..|..|.|.|.|...|.||.|.|:  :.:
 Worm     5 TKRKSIFETIEDLISPDPAPSSSSSSASCSSLDNQKLVCQFCKKTYLTYFGLRRHLQFHK--EGK 67

  Fly   496 SAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKA 560
            ..:.|..|.|.|.|..||.|||.||.|...|..|||.|||||||:||||:||||||:||..||:.
 Worm    68 LQQSCPHCKKVYRSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLKGHLRTHTGEKPFGCEFCGRC 132

  Fly   561 FADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLESAC 603
            ||||||||||:||||.:|...|.||.::||......:| |..|
 Worm   133 FADRSNLRAHLQTHSGEKKHRCSRCGQSFARVQVRQRH-EQCC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 9/21 (43%)
C2H2 Zn finger 469..489 CDD:275370 9/19 (47%)
C2H2 Zn finger 500..520 CDD:275368 10/19 (53%)
COG5048 520..>617 CDD:227381 50/84 (60%)
C2H2 Zn finger 526..546 CDD:275368 15/19 (79%)
zf-H2C2_2 539..562 CDD:290200 15/22 (68%)
C2H2 Zn finger 554..574 CDD:275368 14/19 (74%)
zf-C2H2 554..574 CDD:278523 14/19 (74%)
zf-H2C2_2 566..590 CDD:290200 13/23 (57%)
C2H2 Zn finger 582..599 CDD:275368 5/16 (31%)
snai-1NP_499902.2 C2H2 Zn finger 72..92 CDD:275368 10/19 (53%)
COG5048 98..>155 CDD:227381 40/56 (71%)
C2H2 Zn finger 98..118 CDD:275368 15/19 (79%)
C2H2 Zn finger 126..146 CDD:275368 14/19 (74%)
zf-H2C2_2 138..163 CDD:290200 14/24 (58%)
C2H2 Zn finger 154..170 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.