DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12605 and MET32

DIOPT Version :9

Sequence 1:	NP_001261387.1	Gene:	CG12605 / 38468	FlyBaseID:	FBgn0035481	Length:	619	Species:	Drosophila melanogaster
Sequence 2:	NP_010539.1	Gene:	MET32 / 851840	SGDID:	S000002661	Length:	191	Species:	Saccharomyces cerevisiae

Alignment Length:	82	Identity:	29/82 - (35%)
Similarity:	41/82 - (50%)	Gaps:	11/82 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   516 RSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLES-ACLRD- 578
            |:.||||.:.|..|...|:..|:||.|.:||.......|.:|.|.||.|..|.:|.:: .|.|:
Yeast    90 RNSTGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDTLTCRRNR 154

  Fly   579 -----AGAIDQGKGLEE 590
                 ||    |:|:.|
Yeast   155 TKLLTAG----GEGINE 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12605	NP_001261387.1	zf-C2H2	439..461	CDD:278523
		C2H2 Zn finger	441..461	CDD:275370
		C2H2 Zn finger	472..492	CDD:275368
		COG5048	492..>570	CDD:227381	21/53 (40%)
		zf-C2H2	496..518	CDD:278523	1/1 (100%)
		C2H2 Zn finger	498..518	CDD:275368	1/1 (100%)
		zf-H2C2_2	511..534	CDD:290200	7/17 (41%)
		zf-C2H2	524..546	CDD:278523	7/21 (33%)
		C2H2 Zn finger	526..546	CDD:275368	7/19 (37%)
		zf-H2C2_2	538..562	CDD:290200	8/23 (35%)
		C2H2 Zn finger	554..571	CDD:275368	7/16 (44%)
MET32	NP_010539.1	COG5048	<41..191	CDD:227381	29/82 (35%)
		C2H2 Zn finger	100..120	CDD:275368	7/19 (37%)
		C2H2 Zn finger	128..144	CDD:275368	7/15 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S1379
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950