DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and ZBTB3

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001350037.1 Gene:ZBTB3 / 79842 HGNCID:22918 Length:524 Species:Homo sapiens


Alignment Length:460 Identity:86/460 - (18%)
Similarity:151/460 - (32%) Gaps:162/460 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 KERERDRMR----EQQLVAATAAASI----YRGR-------SVEETEAAHDLLSLSQSLPPLIPP 264
            ||||.|:..    ..::|.|.|...:    |.|:       .||:..||...|.::.    ::..
Human    54 KERELDKRDLVCIHNEIVTAPAFGLLLDFMYAGQLTLRGDTPVEDVLAAASYLHMND----IVKV 114

  Fly   265 C-----------VVTIMKQEQEQLRSPEIQEISNSASSRSPQSTIRFIGSSSYDLMGGSSEGANN 318
            |           ..:..|:|:...:.|.::.:  |::||..|.::....:|.:   .|..|...:
Human   115 CKRRLQARALAEADSTKKEEETNSQLPSLEFL--SSTSRGTQPSLASAETSGH---WGKGEWKGS 174

  Fly   319 CSP---LTPPN-----------------------SDHSSDVDIDMSSSSES-------------- 343
            .:|   :.||:                       :.|....|:.::|.|.|              
Human   175 AAPSPTVRPPDEPPMSSGADTTQPGMEVDAPHLRAPHPPVADVSLASPSSSTETIPTNYFSSGIS 239

  Fly   344 ---------------------------GLQQWGKP------------NPQQNQQRASALKMCLNM 369
                                       .||.:..|            .|..:|..|.|       
Human   240 AVSLEPLPSLDVGPESLRVVEPKDPGGPLQGFYPPASAPTSAPAPVSAPVPSQAPAPA------- 297

  Fly   370 LDGRTKASKAAAVTKQDR------QEPMQPRPKSAQSNASSGGGPPSEPP--ENPAASLGHSSSG 426
             :......|..|:...|.      ::|..|. ::..|..:..|..||:|.  |:|.|: |....|
Human   298 -EAELVQVKVEAIVISDEETDVSDEQPQGPE-RAFPSGGAVYGAQPSQPEAFEDPGAA-GLEEVG 359

  Fly   427 NGENYAKRKRGCYKCCECGKQYATSSNLSRH-----KQTHRSLDSQ------SAKKCNTCGKAYV 480
            ..:::                ..|..:|..|     .|.||.|.:.      |..:.......|.
Human   360 PSDHF----------------LPTDPHLPYHLLPGAGQYHRGLVTSPLPAPASLHEPLYLSSEYE 408

  Fly   481 SMPALAMHLLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHM-Q 544
            :.|. :..:.|..:. :|..|||.||..:.|:.|...||.|:||.|.:|.:::....:|..|: :
Human   409 AAPG-SFGVFTEDVP-TCKTCGKTFSCSYTLRRHATVHTRERPYECRYCLRSYTQSGDLYRHIRK 471

  Fly   545 THSGD 549
            .|:.|
Human   472 AHNED 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 4/26 (15%)
C2H2 Zn finger 441..461 CDD:275370 4/24 (17%)
C2H2 Zn finger 472..492 CDD:275368 2/19 (11%)
COG5048 492..>570 CDD:227381 19/59 (32%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 9/22 (41%)
zf-C2H2 524..546 CDD:278523 5/22 (23%)
C2H2 Zn finger 526..546 CDD:275368 4/20 (20%)
zf-H2C2_2 538..562 CDD:290200 4/13 (31%)
C2H2 Zn finger 554..571 CDD:275368
ZBTB3NP_001350037.1 BTB_POZ_ZBTB3 1..130 CDD:349632 16/79 (20%)
PHA03247 <173..401 CDD:223021 38/253 (15%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
zf-H2C2_2 437..461 CDD:372612 9/23 (39%)
C2H2 Zn finger 452..470 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.