Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137295.1 | Gene: | ZBTB14 / 7541 | HGNCID: | 12860 | Length: | 449 | Species: | Homo sapiens |
Alignment Length: | 318 | Identity: | 78/318 - (24%) |
---|---|---|---|
Similarity: | 120/318 - (37%) | Gaps: | 93/318 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 332 DVDIDMSSSSESGL--------QQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQ 388
Fly 389 EPMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSS-----GNGENYAKRKRGCY--------- 439
Fly 440 ----------------------------------------------------KCCECGKQYATSS 452
Fly 453 NLSRHKQTHRSLDSQSAKK---CNTCGKAYVSMPALAMHLLTHK--LSHSCDICGKLFSRPWLLQ 512
Fly 513 GHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKH 570 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 7/82 (9%) |
C2H2 Zn finger | 441..461 | CDD:275370 | 6/19 (32%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 492..>570 | CDD:227381 | 34/79 (43%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 511..534 | CDD:290200 | 11/22 (50%) | ||
zf-C2H2 | 524..546 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 538..562 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 554..571 | CDD:275368 | 8/17 (47%) | ||
ZBTB14 | NP_001137295.1 | BTB_POZ_ZBTB14 | 18..131 | CDD:349513 | 7/26 (27%) |
Nuclear localization signal. /evidence=ECO:0000255 | 50..66 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 153..194 | 10/40 (25%) | |||
C2H2 Zn finger | 279..299 | CDD:275368 | 6/19 (32%) | ||
SFP1 | <303..383 | CDD:227516 | 29/79 (37%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 319..344 | CDD:404364 | 10/24 (42%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 391..407 | CDD:275368 | 7/15 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |