DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and Zbtb42

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001119774.1 Gene:Zbtb42 / 691556 RGDID:1582758 Length:420 Species:Rattus norvegicus


Alignment Length:433 Identity:99/433 - (22%)
Similarity:154/433 - (35%) Gaps:155/433 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 AATAAASI-----YRGRSVEETEAAHDLLSLSQSLPPLIPPCVVTI---------MKQEQEQLRS 279
            |..||.|:     ||    ::..::.|.:.|:..        :||:         |.:.:..|.|
  Rat    40 AVLAACSVYFHLFYR----DQPASSRDTVRLNGD--------IVTVPAFSRLLDFMYEGRLDLHS 92

  Fly   280 PEIQEISNSAS----------------SRSPQSTIRFIGSSSYDLMGGS---------------- 312
            ..::::..:||                .:.|....|.:|:   :|.|.:                
  Rat    93 LPVEDVLAAASYLHMYDIVKVCKGRLRKKDPDLETRTLGT---ELPGQTPHPLPSWPPAFCQATP 154

  Fly   313 -----SEGANNCSPLT---PPN---SDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMC 366
                 |.|.....||.   ||:   |:.||.. :|:|.          ||.|:..|    |...|
  Rat   155 KAKPPSLGVKAVHPLPKFGPPSWQVSEESSGA-LDLSL----------KPGPRPEQ----AHPPC 204

  Fly   367 LNMLDGRTKASKAAAVTKQDRQEPMQPRPK------SAQSNASSGGGPPSEPPENPAASLGHSSS 425
            |      .:.|:.:::     |:..||..|      |.|.::|......|.||...:|:.|.:.:
  Rat   205 L------LQTSQCSSI-----QQGAQPLVKAEQDSFSEQDSSSPQSADRSPPPVCASAARGLAVN 258

  Fly   426 -------GNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKK------CNTCGK 477
                   |.|                      |..|..|.:.  .:||:....      |..|.|
  Rat   259 LEPLHIQGTG----------------------SQQLGLHAEP--VVDSEDLGPGRHLCICPLCCK 299

  Fly   478 AYVSMPALAMHLLTH---------KLS-----HSCDICGKLFSRPWLLQGHLRSHTGEKPYACVH 528
            .:.|..||..||..|         :||     .:|.:|.|.||..:.|:.|.|:|:|||||.||.
  Rat   300 LFPSTHALQPHLSAHFRERDSVRTRLSPEGAVPTCPLCSKTFSCTYTLKRHERTHSGEKPYTCVQ 364

  Fly   529 CGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHL 571
            |||:|....||..|...|:.:|...|..|.:.|.....|.:|:
  Rat   365 CGKSFQYSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 3/21 (14%)
C2H2 Zn finger 441..461 CDD:275370 3/19 (16%)
C2H2 Zn finger 472..492 CDD:275368 8/19 (42%)
COG5048 492..>570 CDD:227381 32/91 (35%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 14/22 (64%)
zf-C2H2 524..546 CDD:278523 10/21 (48%)
C2H2 Zn finger 526..546 CDD:275368 9/19 (47%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 4/16 (25%)
Zbtb42NP_001119774.1 BTB_POZ_ZBTB42 1..129 CDD:349737 16/100 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..204 12/44 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..248 9/31 (29%)
C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
COG5048 334..>388 CDD:227381 25/53 (47%)
C2H2 Zn finger 334..354 CDD:275368 8/19 (42%)
zf-H2C2_2 347..369 CDD:404364 14/21 (67%)
C2H2 Zn finger 362..382 CDD:275368 9/19 (47%)
C2H2 Zn finger 390..408 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.