DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and ZBTB26

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001291292.1 Gene:ZBTB26 / 57684 HGNCID:23383 Length:441 Species:Homo sapiens


Alignment Length:465 Identity:107/465 - (23%)
Similarity:160/465 - (34%) Gaps:142/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KVIFYAPPASASGSPRQPEPVALKRERERDKEREREKERERD----------RMREQQLVAATAA 233
            |::|      |:|||...:...|...||......:..|..|.          ...|.:||....|
Human    48 KIVF------AAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTA 106

  Fly   234 ASIYRGRSVEETEAAHDLLSLSQSLPPLIPPCVVTIMKQEQEQLRSPEIQEISNSASSRSPQSTI 298
            ||.        .:.:|.:...:|:|...|.|      ||..:.....|.|  |.|..|:..|...
Human   107 ASF--------LQMSHIVERCTQALWKFIKP------KQPMDSKEGCEPQ--SASPQSKEQQGDA 155

  Fly   299 RFIGSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASAL 363
            |  ||...|            ||...|:.|     .:||..|.                      
Human   156 R--GSPKQD------------SPCIHPSED-----SMDMEDSD---------------------- 179

  Fly   364 KMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQSNASSGGGPPSEPP--------ENPAASL 420
               :.::...:....:...:|:|:.:.:...|.:..|         |||.        ||..:.:
Human   180 ---IQIVKVESIGDVSEVRSKKDQNQFISSEPTALHS---------SEPQHSLINSTVENRVSEI 232

  Fly   421 GHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQ-----THRSLDS--QSAKKCNTCGKA 478
               ...:..|||             ..|..|.|:....:     ..|.:|.  |...:|..|.:.
Human   233 ---EQNHLHNYA-------------LSYTGSDNIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRV 281

  Fly   479 YVSMPALAMHLLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHM 543
            :..:...|.||..||| ..|.:|||.|::...|..|:|.|.|.||:.|..|||.|:.:.:|:.|:
Human   282 FRHLENYANHLKMHKL-FMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHL 345

  Fly   544 QTHSGDKNFKCHRCNKTFALKSYLNKHLESACLRDAGAIDQGKGLEEEDDDCSKQDELEMGDELE 608
            ..|||||..||:.|:..||.|..|.|||:.  |....:.|..                       
Human   346 NLHSGDKPHKCNYCDMVFAHKPVLRKHLKQ--LHGKNSFDNA----------------------- 385

  Fly   609 SDENSQDIVV 618
            ::.|.||:.|
Human   386 NERNVQDLTV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 3/26 (12%)
C2H2 Zn finger 441..461 CDD:275370 3/24 (13%)
C2H2 Zn finger 472..492 CDD:275368 5/19 (26%)
COG5048 492..>570 CDD:227381 34/77 (44%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 11/22 (50%)
zf-C2H2 524..546 CDD:278523 7/21 (33%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 538..562 CDD:290200 10/23 (43%)
C2H2 Zn finger 554..571 CDD:275368 7/16 (44%)
ZBTB26NP_001291292.1 BTB_POZ_ZBTB26_Bioref 8..129 CDD:349523 21/94 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..177 16/63 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..216 5/30 (17%)
COG5236 <269..>381 CDD:227561 44/114 (39%)
C2H2 Zn finger 275..295 CDD:275368 5/19 (26%)
zf-C2H2 298..320 CDD:395048 8/21 (38%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
zf-H2C2_2 315..337 CDD:404364 11/21 (52%)
C2H2 Zn finger 328..348 CDD:275368 7/19 (37%)
C2H2 Zn finger 356..374 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.