DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and snai2

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001008581.1 Gene:snai2 / 494038 ZFINID:ZDB-GENE-030326-6 Length:257 Species:Danio rerio


Alignment Length:201 Identity:89/201 - (44%)
Similarity:115/201 - (57%) Gaps:27/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 PMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSSGNGENYAKRKRG---------------CY 439
            |:.|.|    .:.|...|.||        ||..:||....:.::..|.               .:
Zfish    65 PLSPLP----HDLSPISGYPS--------SLSDTSSNKDHSGSESPRSDEDERIQSTKLSDAEKF 117

  Fly   440 KCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGKL 504
            :|..|.|.|:|.|.|.:|||.|....|:.:..|..|.|.|||:.||.||:.||.|...|.:|||.
Zfish   118 QCGLCNKSYSTYSGLMKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKMCGKA 182

  Fly   505 FSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNK 569
            ||||||||||:|:||||||::|.||.:|||||||||||:||||..|.::|..|:|||:..|.|:|
Zfish   183 FSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHK 247

  Fly   570 HLESAC 575
            |.||.|
Zfish   248 HEESGC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275370 10/19 (53%)
C2H2 Zn finger 472..492 CDD:275368 10/19 (53%)
COG5048 492..>570 CDD:227381 49/77 (64%)
zf-C2H2 496..518 CDD:278523 15/21 (71%)
C2H2 Zn finger 498..518 CDD:275368 15/19 (79%)
zf-H2C2_2 511..534 CDD:290200 15/22 (68%)
zf-C2H2 524..546 CDD:278523 15/21 (71%)
C2H2 Zn finger 526..546 CDD:275368 15/19 (79%)
zf-H2C2_2 538..562 CDD:290200 14/23 (61%)
C2H2 Zn finger 554..571 CDD:275368 8/16 (50%)
snai2NP_001008581.1 C2H2 Zn finger 119..139 CDD:275368 10/19 (53%)
C2H2 Zn finger 150..170 CDD:275368 10/19 (53%)
C2H2 Zn finger 176..196 CDD:275368 15/19 (79%)
zf-H2C2_2 189..212 CDD:290200 15/22 (68%)
C2H2 Zn finger 204..224 CDD:275368 15/19 (79%)
zf-H2C2_2 216..241 CDD:290200 15/24 (63%)
C2H2 Zn finger 232..248 CDD:275368 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.