DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and ZIPIC

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:455 Identity:90/455 - (19%)
Similarity:153/455 - (33%) Gaps:152/455 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KEREREKERERDRMREQQLVAATAAASIYRGRSVEETEAAHDLLSLSQSLPPLIPPCVVTIMKQE 273
            |:.::...:|.|..||..:       |.:.| ::||.:                       .:.|
  Fly    86 KDHKQTSYKEDDLDRETTI-------SKFDG-NIEEAQ-----------------------QQDE 119

  Fly   274 QEQLRSPEIQEISNSASSRSPQSTIRFIGSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMS 338
            :||    |::.:..:.:...|...:..:....:..:...||         ..:..||.|:::|:.
  Fly   120 EEQ----ELESVGTTVTLVGPAGIVEEVAEEEHTFIIKQSE---------EEDEFHSVDLELDID 171

  Fly   339 SS-------------------------SESGLQQWGKPNPQQNQQRASALKM-CLNMLDGRTKAS 377
            :.                         .|..|    .|:.:|..|.....|. .::..|.....:
  Fly   172 NEIIINEEEAHEVEEVAHEIEEVAHEIEEEDL----LPHDKQEAQEEDFFKEDTMSDFDEHLDGA 232

  Fly   378 KAAAVTKQDRQEPMQPRPKSAQSNASSGGGP-----PSEPPENPAASLGHSSSGNGEN-YAKRKR 436
            ....::..:.||         |.|.|||...     ||.|.:        .||....| :.||:.
  Fly   233 IEYIISDGEDQE---------QDNESSGEYTVNIQCPSCPEK--------FSSRRAYNVHTKREH 280

  Fly   437 --GCYKCCECGKQYATSSNLSRHKQTHRSL-------------------------DSQSAKKCNT 474
              | |.|.:|||...:.|....|.|.|..:                         ..::..:|:.
  Fly   281 FPG-YVCDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDV 344

  Fly   475 CGKAYVSMPALAMHLLTHKLSH---SCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADR 536
            |.|.:|...||..|.:.|....   .|.:||........|:.|:|||||:||:||..|.|.|:..
  Fly   345 CSKRFVHKVALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQM 409

  Fly   537 SNLRAHMQTHSG-----DKNFKCHRCNKTFALKSYLNKHLESACLRDAGAIDQGKGLEEEDDDCS 596
            .|::||::.|..     .:.|.|.:|..||..:...:.|::.                   |||:
  Fly   410 YNMKAHLREHESPGTNRHRRFHCSKCTHTFINEQNYDAHVQR-------------------DDCT 455

  Fly   597  596
              Fly   456  455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 8/21 (38%)
C2H2 Zn finger 441..461 CDD:275370 7/19 (37%)
C2H2 Zn finger 472..492 CDD:275368 7/19 (37%)
COG5048 492..>570 CDD:227381 27/85 (32%)
zf-C2H2 496..518 CDD:278523 6/24 (25%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 511..534 CDD:290200 13/22 (59%)
zf-C2H2 524..546 CDD:278523 8/21 (38%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 538..562 CDD:290200 8/28 (29%)
C2H2 Zn finger 554..571 CDD:275368 4/16 (25%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 0/19 (0%)
zf-H2C2_2 327..351 CDD:290200 3/23 (13%)
C2H2 Zn finger 342..391 CDD:275368 14/48 (29%)
zf-H2C2_2 383..408 CDD:290200 14/24 (58%)
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
C2H2 Zn finger 432..449 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.