DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and CG4730

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster


Alignment Length:397 Identity:89/397 - (22%)
Similarity:158/397 - (39%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 QEISNSASSRSPQSTIRFIGSSSYDLMGGSSEGA---NNCSPLTPPNSDHSSDVDIDMSSSSESG 344
            |.::.:.:.|:.::.::.:   |:::....|..:   :||..|.......:..:|:.:....|:.
  Fly    10 QTLNFTIARRTAEAPVKLV---SHEVSLSDSTTSLELSNCCRLCLEEPYPNQMLDMTVIYDQEAA 71

  Fly   345 LQQWG----------KPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQ-------------D 386
            |..:.          :.|| :|:.| :..|.|...|.......|..|:..|             :
  Fly    72 LSYYDCYEICTKEDLRQNP-KNEPR-TLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEANTE 134

  Fly   387 RQEPMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSSGNGENYAKRKR--GCYKCCECGKQYA 449
            :::.::.....|..|.........|..|.|..||        |:...|.|  |...|..|.|::.
  Fly   135 QEDDVEDEENEADMNEEFLMEEIEEKQETPIDSL--------EDIVPRNRHTGKSNCKFCHKEFR 191

  Fly   450 TSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHL-LTHKLS--HSCDICGKLFSRPWLL 511
            ..|.:::|:..|  |.::...:|:.|.:.|::..||.:|: ..|:.|  | ||.|||:|:....|
  Fly   192 NHSRMAKHQMIH--LANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVH-CDTCGKVFAIAKAL 253

  Fly   512 QGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQT-HSGDK------------------------- 550
            :.|.|.|..:.||:|..|.:.||.||:|..|.|. |||.:                         
  Fly   254 EIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSRFICEFPGCQKSFTSSSSLRNHECTH 318

  Fly   551 ---NFKCHRCNKTFALKSYLNKHLESACLRDAGAIDQGKGLEEEDDDCSKQDELEM----GDELE 608
               .|:|..|::::..::.|..|||    |....:.|.:.|||.......:.:|.|    .|:.|
  Fly   319 TAMPFECAHCHQSYPARNKLRMHLE----RKHNMVVQMEDLEEMRKFHIVRSKLVMAKIYSDQKE 379

  Fly   609 SDENSQD 615
            |.....|
  Fly   380 SHHAKND 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 5/21 (24%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 6/20 (30%)
COG5048 492..>570 CDD:227381 31/108 (29%)
zf-C2H2 496..518 CDD:278523 10/21 (48%)
C2H2 Zn finger 498..518 CDD:275368 9/19 (47%)
zf-H2C2_2 511..534 CDD:290200 8/22 (36%)
zf-C2H2 524..546 CDD:278523 10/22 (45%)
C2H2 Zn finger 526..546 CDD:275368 9/20 (45%)
zf-H2C2_2 538..562 CDD:290200 9/52 (17%)
C2H2 Zn finger 554..571 CDD:275368 3/16 (19%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 15/79 (19%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..289 CDD:275368 9/20 (45%)
C2H2 Zn finger 296..318 CDD:275368 0/21 (0%)
C2H2 Zn finger 325..346 CDD:275368 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.